DPCstruct | MC58997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 137 ± 24 aa |
| Standard deviation of domain lengths | 23.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420IQ16 | 1-169 | MRIETCYFCSQPCYPSKGITFVRNDARVFRFCRSKCHKNFKMKRNPRKLKWTKAFRKCAGKEMVVDSSLTFAARRNIPVRYNRTLIA… |
| A0A5D2JF89 | 57-197 | MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTHDSTFEFERKRNRPERYDRNLAE… |
| A0A1V8SVX9 | 1-170 | None |
| A0A820AQL3 | 131-243 | None |
| A0A5C2SQ70 | 305-449 | None |
| A0A2G3BI24 | 73-225 | None |
| A0A444XEI0 | 1-91 | None |
| A0A7R9Q351 | 2-138 | None |
| A0A287D0M0 | 1-139 | None |
| A0A819P4D7 | 116-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.