DPCstruct | MC58990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 159 ± 9 aa |
| Standard deviation of domain lengths | 8.52 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7QNP1 | 21-174 | FIGHSNAYSLDINAYWESAQAPGNGVLYTGLTFSNWKGTCANGAQRAPIQLLCSSTTPCTGLNINNFAIWTDTGSYEYYKCQNAWGD… |
| A0A507BDX1 | 279-448 | MFMIKSNGGSGTVRDCAFTNFIGHKNAYSLNIDAHWTQLKLQPGSGVQYENLNFTNWKGSCSDGARRGPINVICPDAQPCHGITISD… |
| A0A1C7MC71 | 1128-1273 | None |
| A0A4Y9ZD79 | 265-420 | None |
| A0A165ZT93 | 92-250 | None |
| A0A1Q5UGM8 | 117-267 | None |
| A0A286U7M9 | 887-1057 | None |
| A0A2H3GEV3 | 550-715 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.