DPCstruct | MC5899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 51 ± 5 aa |
| Standard deviation of domain lengths | 4.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 50.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4X857 | 1-51 | MPSWKCSNCGYTLDADAHPNECPSCKEKCEFLDNTCYTPDCAYEGTDDRIG |
| A0A1W1WYI2 | 1-60 | MSVWKCNKCGNTVEATTPPETCPSCKEKCEFIDVTCYIPECGGPDSGNVNPQVFQESYKS |
| A0A7C2WLB4 | 1-52 | None |
| A0A1Q9N0E1 | 1-56 | None |
| A0A7X8H3S6 | 32-80 | None |
| A0A524QCH6 | 46-94 | None |
| G0H133 | 1-56 | None |
| C0QD20 | 19-68 | None |
| A0A7C3Y2F7 | 228-275 | None |
| A0A2T0AQE4 | 1-43 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.