DPCstruct | MC58987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 171 ± 22 aa |
| Standard deviation of domain lengths | 22.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8N9P1 | 1-163 | MVYYIRFLKTPRIQKQKAGSLSISALICITTDLGDAYLAQDVDLVVSLSLKDSEKVLHQEPLSWKAGKRELAILLGPFHPQLSQHAI… |
| A0A139HBX9 | 1-153 | MHYVRFLKTPKVRVDRGTVTLQAVLTLTTDLGETFYPNALELIACLRDTADDGDIYLRKKLQWEAGARAVNVSIDLSRQDIEWPACM… |
| A0A066WYK1 | 1-185 | None |
| A0A3M7MIC2 | 251-410 | None |
| Q2GT47 | 1-174 | None |
| I1CL92 | 1-233 | None |
| A0A084QXC0 | 1-173 | None |
| A0A4S4LUW7 | 1-171 | None |
| A0A2W1GB69 | 1-161 | None |
| A0A1F5LF91 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.