DPCstruct | MC5898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5UFE5 | 1-90 | MASVVPVKDKKLLEVKLGELPNWILMRDFSPSGILGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFNYSISYKHLKHEWLRKY… |
| A0A444UQB8 | 797-886 | CAVPLAERRLMEVRLGELPAWLGSRELQPATGLAAMRRGWQRYYSKYIDVKKGGAGGVAMLLAAYCVLSYSWNYQHLSKFSDERQRN… |
| H9ZFM2 | 1-82 | None |
| A0A674JZZ8 | 44-128 | None |
| A0A3Q2U7Y0 | 95-182 | None |
| A0A6J3E1Q5 | 227-311 | None |
| A0A3P8SVA2 | 1-81 | None |
| A0A7M4FF59 | 127-206 | None |
| A0A3P8SGW4 | 225-308 | None |
| A0A667ZXE7 | 545-620 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.