DPCstruct | MC58978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 190 ± 26 aa |
| Standard deviation of domain lengths | 25.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 19.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6TPH0 | 6-217 | PTLMSAVYEECRQILGNNPAVSDVREAVALAVATAERVWGDLQDESPAYACRKGCAWCCHQTVMVIAPEVIFVADHIFRSFEIPERE… |
| A0A0L6JLW0 | 57-249 | LLEELLDKETKKPLNISMENGLTLLKDVYLTFDDAIDEFKKYSPCDKGCWHCCCAIVETAVIEAENIRRYVNENFDENKVGQLSEKV… |
| M1Z2T7 | 37-245 | None |
| A0A1F5PHK1 | 12-198 | None |
| A0A432RD08 | 17-170 | None |
| A0A257B5U8 | 5-196 | None |
| A0A661P651 | 1-165 | None |
| A0A644SYS0 | 27-266 | None |
| A0A7J5WLX1 | 14-183 | None |
| A0A3M1EB24 | 35-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.