DPCstruct | MC58976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 206 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Standard deviation of domain lengths | 16.36 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.72 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | CL0158- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C2RY81 | 78-193 | QKVPVLMYHAIDDYHGQGIKDLFVSPANFEAQMKYLKDNGYTLLTFERWGDINKVNKPIFVTFDDGMKNNMNAFHVLQKLKDDTFKP… |
| A0A0L6JL79 | 36-142 | LKKGLYIFFYHSFVDTEKCKKDGRLISLSSVDRKAFESQLKYFKTDYTVITLDEAYELMKSNKPLDRRYLVLTIDDGYKDNFIYGYE… |
| H1LI18 | 35-163 | None |
| A0A8B5XFR5 | 112-290 | None |
| A0A1E2UU27 | 74-172 | None |
| A0A2X2RNR1 | 39-142 | None |
| A0A7G8TAR4 | 2-109 | None |
| Q1AUP9 | 6-122 | None |
| A0A7W1BLH3 | 698-809 | None |
| A0A0M2HXJ0 | 193-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.