DPCstruct | MC58975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 135 ± 19 aa |
| Standard deviation of domain lengths | 18.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14078 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L6JKJ0 | 1-123 | MGCWGVGIFDDDLALDIRDLYDDVIKKGYSDSIASAMVMKLYNEPANNEDDGIIVYSALSCIQLSRSNLFQNIREKTIALIDSNSGL… |
| A0A3D0IH80 | 1-123 | MGTWNASINGNDTAQDLLDEYKAAFFYYDVPAALLKIDQYVRTMVDESDEDEWCAYMYSLAEFMWKKGILTDEIRDRAVEMVDSDFG… |
| A0A2A7JZ89 | 1-163 | None |
| A0A1G6LE36 | 83-223 | None |
| F2JQM4 | 1-121 | None |
| A0A1Q8LVA1 | 155-288 | None |
| A0A1H9GNG2 | 1-156 | None |
| R7F5Q5 | 1-134 | None |
| A0A831TNR5 | 1-104 | None |
| A0A4R5TVT7 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.