DPCstruct | MC58973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 333 ± 61 aa |
| Standard deviation of domain lengths | 60.91 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.83 |
| Pfam Score | 92.42 |
| Assigned Pfam label(s) | PF20220- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L6JJP1 | 800-1156 | PLHDQLRNNQKNALIDYLLQQKELIDWNVTDSNGLFEYFLIDVEMDACMETSRIKQAISSVQLFIQRCFLGLEEEPSGIKPDILDRL… |
| J7TP80 | 450-784 | KQLQNQSEPCRSEALSGEYRALVMGKPLANRDDIWRTLLIDGKVSAEITTTPLADAIAGIQLYINRTVAGDEPGADNAVLERQFFKD… |
| A0A5M9M8C2 | 158-411 | None |
| A0A0D8L8E9 | 160-431 | None |
| A0A103EKL0 | 1-371 | None |
| A0A4V3F8P5 | 5-287 | None |
| A0A509C3A2 | 4-364 | None |
| A0A0N0WPR3 | 6-416 | None |
| A0A4D7JP61 | 736-1029 | None |
| A0A3M3G8N2 | 374-783 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.