DPCstruct | MC5897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 263 ± 25 aa |
| Standard deviation of domain lengths | 24.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5UAH8 | 2-247 | ATTISKLKVDLDFDSSSISQIHLVLFGFQDAVNKILRNHLIRPHWMFAMDNIIRRAVQAAVTILIPELQAHFEPTCETEGVDKDMDE… |
| A0A7F5R0J4 | 88-340 | ETVLNNQHLEILMNGLKSYIADPSPVVIEPAIRQLKEELGSDAHTMSQLHFAIYLYQESVNEILRRHPIKPHWMFALDNLVRSGMQA… |
| W6NF31 | 22-306 | None |
| B4GMM8 | 17-288 | None |
| A0A151P717 | 1-220 | None |
| A0A803YG37 | 1-276 | None |
| A0A2C9JMY3 | 982-1263 | None |
| A0A0B1S5M6 | 3-256 | None |
| A0A670Y8Y6 | 7-305 | None |
| A0A452GPQ7 | 34-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.