DPCstruct | MC58955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 159 ± 27 aa |
| Standard deviation of domain lengths | 27.30 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.83 |
| Pfam Score | 98.68 |
| Assigned Pfam label(s) | PF00940- PF14700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7JDA3 | 2-130 | SCDNPEDYVSHLPIHQDGSCNGLQHYSALGRDQSGAMAVNVLPSDTPRDVYSEVAALVEQWRAADAAKGNETAKLLEGQITRKVVKQ… |
| A0A6I2J8A6 | 2-184 | CFEYAGVTHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSETVQDIYGIVAQKVNEILKQDAINGTPNEMITVTDKD… |
| A2YYV2 | 526-684 | None |
| A0A0V0YC22 | 314-465 | None |
| A0A183WN36 | 18-187 | None |
| A0A453T4C2 | 247-389 | None |
| A0A0J7Y941 | 132-248 | None |
| A0A7G7YDV7 | 20-136 | None |
| A0A6P6GIL8 | 100-241 | None |
| A0A4S4D913 | 51-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.