DPCstruct | MC5895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 296 ± 25 aa |
| Standard deviation of domain lengths | 24.79 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S0MN45 | 4-292 | KTKAELVKEGKELNAALTAIRKKPHNFALLVGKDGLILETDLKKSPEGLRGKAKKAGGGAKGAVGEISATGKDITLKLAEGENPPGT… |
| A0A7C4UEQ1 | 124-369 | ELLQMVKRLKMAKIDQPLRFAVVMKSPKEGALALSKKKVTPDQIKEAKSNAGGGRVVARGICFTEEGKSIFETPKEVPAALSKVVKF… |
| A0A1H7DW12 | 3-312 | None |
| A0A1H7DVV2 | 1-252 | None |
| A0A2E3PE79 | 6-309 | None |
| A0A4R6QIJ4 | 90-401 | None |
| A0A842IAU0 | 8-313 | None |
| D2R651 | 7-332 | None |
| A0A843YEK9 | 6-305 | None |
| A0A2E3PIX4 | 186-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.