DPCstruct | MC58949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 178 ± 32 aa |
| Standard deviation of domain lengths | 31.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.67 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0063- PF07923 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7IXQ1 | 8-156 | IPKLREILRRQRGDSESSDAPDVEFVYDDADEHTVELAELYSYTEYPDFALNKQAFTEHFAQYGRHDGGWSTANDSLRSNYLLHLLN… |
| A0A822B9X8 | 4-162 | ASVVRRVVNKPRDVIPRNPAINPDTLLDVPEFNFIYNDSDTIYAEIAELYTYSEEPEFVWNAEAFNILFQAKYGENKKWKDYSKDDK… |
| A0A1I8IRI2 | 8-224 | None |
| A0A369S8T2 | 1-174 | None |
| A0A1Y1VFE7 | 116-280 | None |
| A0A3Q0IYP9 | 1-119 | None |
| A0A3M0IPC7 | 19-207 | None |
| A0A4P9XEJ0 | 100-278 | None |
| A0A183UWB6 | 61-238 | None |
| A0A5K3FGP0 | 1-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.