DPCstruct | MC58948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 554 |
|---|---|
| Mean domain length (aa) | 71 ± 10 aa |
| Standard deviation of domain lengths | 9.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.42 |
| Pfam Score | 98.30 |
| Assigned Pfam label(s) | CL0056- CL0159- CL0004- CL0005- CL0602 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E7FCC2 | 141-201 | TLITCDNPTPPEHGNVMFRSPVLYNDVIKYSCQENYTLVGNRSLTCGDDWDYNFPPPKCEA |
| A0A7J7IVD2 | 32-107 | PVSLMGTATSCGRPPYVEHGSFKVTSGYKFTDHVEYTCFSDFMLNGVNFAVCLSNGSWSKPPSCLPAARKCNRKSN |
| A0A2G8LAJ3 | 19-85 | None |
| A0A2D0PM40 | 163-224 | None |
| A0A2D0Q941 | 578-658 | None |
| A0A2D0QGZ3 | 80-141 | None |
| A0A2I4CW32 | 3-95 | None |
| A0A3B5QT18 | 133-208 | None |
| A0A7R8X6G6 | 136-202 | None |
| A0A7R8X1H5 | 195-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.