DPCstruct | MC5894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 118 ± 20 aa |
| Standard deviation of domain lengths | 19.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0G5I1 | 3-144 | ISVYLVIAVLVLYSLFVLLSNWRYKTQLNRLFSLRDKSAAKVFNFGQLSGLPSPVEKYFRLVLKEGSIYPGTIRLKHGGQFKTALDK… |
| A0A0F2JJN1 | 2-87 | LQALTRVGTIKASILSERDIKHMPTPVQRYLNYVGVVGKEKVQNFRISFEGEMKMDPKKDWIPVKTEQYNFVDNPARMFLSRLRWL |
| A0A261CXM9 | 29-117 | None |
| A0A839GQK3 | 114-223 | None |
| A0A7J5UUX0 | 297-404 | None |
| A0A4Q5STH1 | 104-233 | None |
| A0A7W9HGR6 | 1-90 | None |
| A0A4U2YPA8 | 72-205 | None |
| A0A1M3NLD0 | 3-110 | None |
| A0A849QTP3 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.