DPCstruct | MC58938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Standard deviation of domain lengths | 11.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T1VIJ2 | 1-110 | MKNAPNLKKQPADLMEESIIFAGADAWTFAKAWQEMNPIGDTVPPVVLDKKQLAELENIRIVDDGRLYTRVCRGGHLTERQITILAT… |
| I2SP58 | 1-114 | MKSAPNLKKQPYDKMTEVIIFAGSDAWAHAKQWQEQDGRLAGDNVPPVVLADDQLDELADLRIIDEGRYCVRLYKAGHIRPSNINAI… |
| A0A8B3HGY9 | 1-122 | None |
| A0A2M8RSV6 | 4-141 | None |
| A0A379V351 | 1-114 | None |
| A0A376RHQ3 | 1-107 | None |
| A0A2X3FPU1 | 1-118 | None |
| E8KJQ2 | 1-145 | None |
| E6KZH7 | 4-134 | None |
| A0A0J5P4U3 | 4-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.