DPCstruct | MC58931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 280 |
|---|---|
| Mean domain length (aa) | 124 ± 17 aa |
| Standard deviation of domain lengths | 17.19 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0023- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8CXW9 | 34-142 | SAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTSHWAPFNGWE… |
| A0A812LL17 | 146-265 | TCIVVSGCSHAVVGNIVNGSYVRTAENHGKPVYKKTEQTKDGVDVHIYFWDDKQNPTFCGWWFGPRVGAEEVWAYNPGRMLGTAPLG… |
| A0A6U4VIJ4 | 117-274 | None |
| A0A812NQ58 | 795-923 | None |
| A0A812P9Y3 | 140-235 | None |
| A0A1Q9E474 | 768-969 | None |
| A0A7S2IYW7 | 182-282 | None |
| A0A813FRA6 | 386-521 | None |
| A0A812UQX0 | 286-408 | None |
| A0A6P4ZTF6 | 16-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.