DPCstruct | MC58930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 257 ± 36 aa |
| Standard deviation of domain lengths | 36.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04114 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8CR05 | 6-249 | LLGGSMVLFALGLWFESGESKSNDPAIKVPNIVNCNLDLMSYVPVILVGYLSGIALFLPEMAAKLGTKYFDKSAETSIFIALTLWIL… |
| A0A1S3DBV0 | 24-223 | LESLNLVRVGVIFLLTHGMGILLMSSVPAITQYLQGPTDKALFLAFATVSVASVVFTVVYKLLFPVDNDWSFYFIFCRVELGLATMC… |
| A0A0A9PB41 | 136-427 | None |
| A0A2I0RZ64 | 335-652 | None |
| A0A1B7T8M5 | 3-232 | None |
| A0A0W8CG98 | 51-354 | None |
| A0A5C6P241 | 589-871 | None |
| A0A6P7Z9E6 | 247-493 | None |
| A0A2W1BWR1 | 391-714 | None |
| A0A177WZB7 | 267-551 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.