DPCstruct | MC58929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 289 ± 75 aa |
| Standard deviation of domain lengths | 74.72 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7HRU5 | 13-266 | VLHHDTGALSTIRQAIVDNWPDGIQREMAICGSGWMFKVKGTPFFTCSSSSSSQARLMIAVILQKLYSIGWKIVVSCDLARFNDKSS… |
| A0A7R8CLX1 | 34-282 | AGKDVVHIFEKILSPRNLIQGTRYKDETETYKIKIHGMPFTLAAGSSVDFKISFLHILDQLYIELQMVPFVSSDLCLSTDTSTVFFE… |
| A0A1Q9CLU5 | 326-737 | None |
| A0A1V9YMG7 | 1-161 | None |
| A0A2H4SKK8 | 28-285 | None |
| A0A7S2C1L2 | 2-306 | None |
| A0A1I8ITV7 | 322-615 | None |
| A0A812N3D4 | 48-415 | None |
| A0A1I8IIT1 | 3-172 | None |
| A0A1I8I5Q0 | 1-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.