DPCstruct | MC58927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 324 ± 71 aa |
| Standard deviation of domain lengths | 71.04 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 77.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.62 |
| Pfam Score | 93.17 |
| Assigned Pfam label(s) | CL0020- PF20981 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356KZT1 | 479-737 | TGATLVLLDLDPAAALHFDEISTLIRDLPPGFQGFFEVPAGVHWVASADPELRQAPGRWFVAKAGAVVVLELRGGRLRRPDPERAKR… |
| A0A7R8CGQ3 | 30-375 | FLILLDVPPKIEFGIDLNSWRTGTKFMGVKMIPPGLHFIYYSPVSKEGQVAPRTGFFHKFSKGEVLVKRWNDTSEQLDTVHDTQPFK… |
| A0A812T3C6 | 38-390 | None |
| A0A2T3A6G0 | 58-695 | None |
| A0A1N6LWA9 | 30-401 | None |
| A0A0V0J765 | 5-350 | None |
| A0A6P8ATU9 | 75-483 | None |
| A0A370TI04 | 181-540 | None |
| A0A2T7PTG8 | 127-476 | None |
| A0A6A5DBC0 | 223-612 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.