DPCstruct | MC58921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 191 ± 11 aa |
| Standard deviation of domain lengths | 11.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0YSU8 | 2-172 | TRWANEDWRKALREVIYWYLNANHSSRGIDAGIILAQAAIERLSYEFVVKDRRLLTVNGFKDLWASDKFRLLFSSLGIPLDIPAETP… |
| A0A6G2BE00 | 184-385 | TPWSGGHTLVDPVNAEILGGLIACTDSAWPDSYRKDVFQYAVNYYIDGCAGDPIELATSTFQAGLELLSWAVLVEELQLVSRRDYRP… |
| A0A354B4V6 | 13-215 | None |
| A0A6P1BW84 | 5-193 | None |
| A0A0P7W7K1 | 232-420 | None |
| A0A2M9KE85 | 301-493 | None |
| A0A7K3ZX95 | 3-186 | None |
| A0A7W7SR17 | 33-243 | None |
| A0A6N8W4E5 | 240-426 | None |
| A0A7Y0IE36 | 265-444 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.