DPCstruct | MC5892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 148 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5VBN2 | 19-134 | LNEKDLLLGLRTYADLSGGRYPTSLETEITLKEIETNQLGSNLTDTPKSQKDQMVLDIFFATAFYDKLIREKRGAQYHGDTVSRQDV… |
| A0A2A2WCY2 | 1-148 | MTNSPGGMILTAGPEFRNDDDAIEMLRLCALANESKYPLWLSVNDSDGTPMAIQNKFVTSLQDQVNQGTESEKAAALESAQRFGTAV… |
| A0A5C6D513 | 2-119 | None |
| A0A1G3A2W1 | 98-246 | None |
| A0A1G2YTR3 | 244-394 | None |
| A0A3N5V614 | 266-437 | None |
| A0A3N5UZC7 | 41-197 | None |
| A0A7V7D4F3 | 286-434 | None |
| A0A177PZH3 | 189-334 | None |
| A0A5C6F927 | 274-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.