DPCstruct | MC58919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2117 |
|---|---|
| Mean domain length (aa) | 100 ± 20 aa |
| Standard deviation of domain lengths | 19.69 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.69 |
| Pfam Score | 98.40 |
| Assigned Pfam label(s) | CL0023- CL0258- CL0205- PF02547- PF07743 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0YJA9 | 3-92 | KRDYYEVLGVPRSADNTQIKKSYRRLARKYHPDVNPDDPKAEDKFKEATEAYEVLSNSEKRNRYDMFCNLKFLYKISNNSSSKLSYV… |
| A0A7D9H0L8 | 13-107 | EERELIKDKEIKRIIRCFRLDYYTVLGIQPGITKEDIAKIYKKKSLLIHPDKTRNPRAVDAFDLLRKAATALADDKKRAELDNTWAD… |
| A0A7S4P7X4 | 54-167 | None |
| A0A7R9T310 | 279-388 | None |
| A0A6N2DPU1 | 1-105 | None |
| A0A4Y7L831 | 5-70 | None |
| A0A4Z0Y9H7 | 7-114 | None |
| A0A4Z0Z3P6 | 6-101 | None |
| Q50312 | 2-80 | None |
| A0A259MCV5 | 2-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.