DPCstruct | MC58903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 345 ± 84 aa |
| Standard deviation of domain lengths | 84.45 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.11 |
| Pfam Score | 80.43 |
| Assigned Pfam label(s) | CL0023- CL0123- CL0465- CL0220- CL0235 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8A4A6 | 354-684 | MKNPPAGVKLVMETVCQMLSIKPNKVNDHTNSAKKVNDYWGPSQALLADTKFLDTLRAYDKDNIAPHIITAVRPYIDMPEFEPSVVK… |
| A0A2C9LZ77 | 2-207 | AICQWVHAMFKYHFVAITVAPKREKLKKAMEELATTEKILAEAKKKLHEVEAGVAKLQKQYNESMHKKKILEDKCKLCEARLDRADK… |
| A0A821G1B3 | 48-443 | None |
| A0A0M3ILM2 | 10-339 | None |
| W2P9Z5 | 271-674 | None |
| A0A7R9B553 | 18-332 | None |
| A0A3P8GZG1 | 3-299 | None |
| A0A4Z2EPQ9 | 164-642 | None |
| A0A816RR26 | 64-265 | None |
| A0A2P8YMB4 | 289-687 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.