DPCstruct | MC58901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 269 ± 32 aa |
| Standard deviation of domain lengths | 31.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4K731 | 1-244 | VRLNLQVMALICQKGDRFQLLMNTLIKEFREDLELLEKRGSLIIRLLAVHLHAEKIFRALAPILEKETDVEYASLMVQTLNFILLTS… |
| A0A2J7ZYW8 | 7-292 | LEALRWLHFLLARAQDLVLEQVGRLLNPLLDSLSAPSDVVVTSALGVLAAIADCPGQFTPVLVALLDRFRGEAGFALLQRSGSSLVR… |
| A0A6A5DMN4 | 256-584 | None |
| A0A812LNP3 | 14-238 | None |
| R1C1N8 | 37-285 | None |
| A0A812J381 | 580-857 | None |
| A0A183U2A1 | 41-287 | None |
| A0A7S2Z3C3 | 2-268 | None |
| A0A1X7TRR6 | 157-408 | None |
| A0A7S0L690 | 2-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.