DPCstruct | MC589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 425 ± 39 aa |
| Standard deviation of domain lengths | 38.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5AZ07 | 1-436 | MRRLDLRKKSFLPRLLTIRVFWCPYQRAVYGRDLCVNTPIFFELSTMEALISLWGGFLRDHLFDQGYRCSSCEMPSEAHVHCYTHRQ… |
| A0A077Z3X9 | 731-1086 | CRFTALLSSYLLKSGVPSRYCINPHTFSVKLYGPTDLPLGVYLEDYCLDADCQCPREGCEEKMVNHIRRFVLGSTSVEVSVHAMGVP… |
| A0A835RK72 | 7-370 | None |
| A0A1D6LDK2 | 224-693 | None |
| A0A5J5BEI9 | 485-928 | None |
| O59722 | 926-1332 | None |
| A0A1Y3NIZ9 | 121-576 | None |
| A0A1B6EEB8 | 622-1097 | None |
| A0A835RTB7 | 245-685 | None |
| A0A7J7IB15 | 23-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.