DPCstruct | MC58898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 184 |
|---|---|
| Mean domain length (aa) | 202 ± 42 aa |
| Standard deviation of domain lengths | 41.99 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.10 |
| Pfam Score | 99.17 |
| Assigned Pfam label(s) | CL0431- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7ZVZ2 | 14-190 | IFLTWHTTYIRPQLSIEQSALSIEHIVPRATFRKLTPQLDSDMHNFMLYPMRLNAKRGTLPMTEAIRIGHETQALGRASGDSMAVHK… |
| A0A848UZX2 | 34-247 | RAWLKVNTYDPVFDDQGYNGIRIAMYSYIDEVGGQVECVYSGFQQPAAAVTFLNPINAEHIIPQSWFGSASPMRSDIFNLRPSHESA… |
| A0A166AFE0 | 126-342 | None |
| A0A2N5YZR5 | 1-160 | None |
| A0A453E7Q9 | 13-160 | None |
| A0A0S4Q040 | 2-134 | None |
| A0A2W4WXW0 | 27-268 | None |
| A0A1F3IPK4 | 53-288 | None |
| A0A449BKR4 | 122-303 | None |
| A0A857DDI4 | 208-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.