DPCstruct | MC58896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 288 ± 37 aa |
| Standard deviation of domain lengths | 36.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7HTR3 | 2-239 | SSGAPTRGGAHVLPTGRNFYSVDPKAIPSGLAWDVGCALADRLLERHLDETGTYPRTVGVVVWGTANMRTQGDDVAEVLALLGVRPR… |
| A0A2J7ZNA6 | 136-397 | PTREVLAARLEEALEIRSLLLQNTQELDGVLRALGGGYVLPEAGGDLLRDGTGVLPTGRNIHALDPYRMPSPAAMARGSAVAAAVLQ… |
| A0A7G9ZA00 | 347-569 | None |
| A0A7W7A4Z3 | 514-795 | None |
| A0A396QIY4 | 3-250 | None |
| A0A2N9IQT3 | 220-523 | None |
| A0A0B8PBR4 | 179-418 | None |
| A0A1E3H0K6 | 370-655 | None |
| A0A7J9T4V9 | 125-405 | None |
| A0A843DZZ9 | 613-914 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.