DPCstruct | MC58894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 9.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 44.23 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | CL0001- PF03016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7ZIK5 | 1-133 | MRDGRTPHARCECPITRHGLDCAIPLRDPTQQCALYSHTAATCHSHARSLCLNGCNLNGWCEGGFCKCKPGSYGADCALSTGADGRP… |
| A0A150G7H1 | 2-107 | GCDCPRHRDGPGCSRRLMRSALQQRCHEQAYTSIKECLGKEQGCLNSCNRRGTCVAGFCHCNPGHYGADCSLSLGPDGKPVLLAGSG… |
| A0A835YBQ3 | 137-259 | None |
| D8U9S3 | 2-107 | None |
| D8TNG1 | 43-159 | None |
| A0A250XI13 | 80-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.