DPCstruct | MC58893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 325 ± 22 aa |
| Standard deviation of domain lengths | 22.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 68.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 23.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836BZS0 | 711-1041 | AFFSCSMCLLVTQAASRAALLRRVGGQAATWLLWAAATALLNVSSASHKATDGPGVARVLACQPHRLLAAGCKLLCDTIATPSSPNT… |
| A0A2J7ZHM7 | 1-317 | MAEAALASRATAQGGNTLCPAEHCISVEHEAFALAARSACLLAAPLALCAARGSAAIELDPGQLDMLIVGVQDAVWGLTAWAGSARG… |
| A0A150GUM1 | 317-635 | None |
| A0A150FV42 | 376-694 | None |
| A0A150G336 | 1-286 | None |
| A0A835Y0Y8 | 111-445 | None |
| A0A2J8A9R3 | 1-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.