DPCstruct | MC58882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 218 ± 22 aa |
| Standard deviation of domain lengths | 21.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8LIK6 | 5-182 | SNNEEDYIYCAMLDPWRCGRPVGAVDQAHHLMDIDYIDHSGDAARDGAVCPHSTDHTNGEVYPSHQWCQGLLYYYLGTGDEEALRIA… |
| A0A7C7Q5X8 | 692-918 | YLANREFQREYGMLNFGDWYGERTYNWGNHEYDTPHCFLLQFARTGERGFFDIGEEAVWHMMDVDMVHYHKDARMLGAVYVHSLCHV… |
| A0A3D1UST7 | 176-421 | None |
| A0A1G0XP03 | 505-750 | None |
| A0A7X8XAR1 | 46-246 | None |
| A0A660Y723 | 371-592 | None |
| A0A7Y5UV61 | 242-465 | None |
| A0A1F5YHA8 | 2-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.