DPCstruct | MC58881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 193 ± 21 aa |
| Standard deviation of domain lengths | 20.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5LN57 | 391-603 | GFVMEMADATEYPTFDAFRKHMREVKLAVAWNAEKKHVEVNYASGKDTLEMVFDPGRYPAVSRKVNGQWPYVPKGIMRESSWAIQGS… |
| A0A7Y5IUC5 | 368-548 | EVADQSAHPDAPSFAREVAGGTVRDGVAPPFTSYRDDARRPWVLEYAREGKTLGLEVDLMEWRLLRRWNENGDLGWPMLESPMARQN… |
| A0A2E8WBX5 | 518-677 | None |
| A0A1V5M4F3 | 760-974 | None |
| A0A1V5LWV4 | 436-650 | None |
| A0A7C7XVI0 | 92-259 | None |
| A0A7V3AEC3 | 886-1066 | None |
| A0A6M4GXG7 | 463-685 | None |
| A0A090W822 | 133-314 | None |
| A0A3B8MLZ2 | 239-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.