DPCstruct | MC5888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 191 ± 26 aa |
| Standard deviation of domain lengths | 26.06 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379FMH3 | 101-281 | KITAQQCIITGAVILSILAIGMPTAKWISTATGFTIPGHIFSLFVGVVFHSINERKPIIKISRNTVVLISTLSLEMFLVMAMMKLKL… |
| A0A354KSQ8 | 47-231 | ILCLKKLMTGASFLFIAMGLGSLISDLIQNLGLTFPSYIGAMLAAAIIRNLYDFLGKEIVEKEIETLGSLSLSFFLTMALMGLKLWQ… |
| H1D946 | 1-161 | None |
| W1EX18 | 148-338 | None |
| A0A090PDF5 | 45-249 | None |
| A0A448VRZ0 | 24-292 | None |
| A0A3A5K858 | 120-305 | None |
| A0A6I1ISX6 | 1-178 | None |
| A0A2X1NTT9 | 14-183 | None |
| A0A090REN1 | 55-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.