DPCstruct | MC58872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 180 ± 29 aa |
| Standard deviation of domain lengths | 29.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07047 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9NLT4 | 41-212 | IGSLIVRTLAKPVANQLKAQAKQHERFRGMCISLAQTMHRNEMRMRINLLREGVKEGLPEPKIRPLNEAKAVDTGANFISEAFIFSV… |
| A9URM1 | 1-162 | MAALPLGKILALTVRTLSKPVSKLLKDQAKQHGVFRNRFLIPVGQVTHWVGVRLRRLTLGSSRKEVTPLDAAGATEYGAEFLGEAFI… |
| A0A0N5D713 | 793-928 | None |
| A0A6G1MFD6 | 6-238 | None |
| K3WNZ7 | 36-236 | None |
| A0A438N0I2 | 1-210 | None |
| A0A816UK39 | 1-168 | None |
| A0A4U0VIN8 | 4-238 | None |
| G3JLH7 | 7-213 | None |
| A0A397JDC3 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.