DPCstruct | MC58870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 208 ± 37 aa |
| Standard deviation of domain lengths | 37.18 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 66.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.41 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0511- PF07962 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7FKE8 | 15-265 | VADGSDEDSGMERTDAAGANNGSEPGRDSTGVAAPEEATTAKKVSNRPPAFSENHLVKEKGLWQIYKDFPQKCQYKGRGREAEFLRG… |
| A0A0E9NKP8 | 63-256 | EIDTDLRIPANALNDSTAAFSSHHRSSGEGLGLDEEVVIKPRKERVKLNEERLLGPMGLPKLRKDAPMKLKFKGKGHEFRDLSNLLN… |
| A0A7I8XGJ2 | 1-184 | None |
| A0A830HBE7 | 2-211 | None |
| A0A1Y1YDX0 | 16-241 | None |
| A0A803LRN6 | 2-237 | None |
| O14350 | 1-165 | None |
| A0A0S2LIU2 | 118-346 | None |
| H0XH71 | 1-200 | None |
| A0A5K4FDW9 | 73-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.