DPCstruct | MC58869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 177 ± 27 aa |
| Standard deviation of domain lengths | 26.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0GS42 | 3-142 | YDYHLLFNPNSTQEHFDLALRHYQILHETPLPVIVTLCVVAGIGLVGGTIKVFKPNPELQMFEYCSLGLYVLAICVFLTNVKTGIDC… |
| A0A0E9NIT2 | 11-185 | GSVLIIAATSFCLGILFSNWSADHSVLWVSELTEQAVEAAETHYLLLAHCPRVMQVVLHSIIVWGFIGHVLKLYRATTSNYLFDGAS… |
| A0A836DCX8 | 234-386 | None |
| L2FHU2 | 23-167 | None |
| A0A427XYT6 | 4-167 | None |
| A0A4Z0A3D4 | 915-1088 | None |
| A0A109FLY2 | 469-721 | None |
| A0A284QV82 | 426-600 | None |
| A0A066WWC0 | 1-148 | None |
| A0A2U3DRE4 | 148-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.