DPCstruct | MC58866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Standard deviation of domain lengths | 14.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06212 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9NGV1 | 54-179 | IMSAAGLPSQDLPPQGGYEPVQYKRNLPMRGFRPSYYLLGMGLICGYGFYAFGKGVHERRELKREKTWSRIYLTAVLQAEVDRDNYR… |
| A0A2U3DUG6 | 559-671 | MVQDMPPKGGYEPVQYKRNLPAKGFRPGILLLGMGAIMGYGWYKLVGGIREANELAREKMWARIHLIPLLQAEEDRDQVRRYWADQK… |
| A0A395IJW7 | 69-166 | None |
| A0A1W0X858 | 26-173 | None |
| A0A7S2XZQ7 | 12-128 | None |
| A0A137QYE3 | 1-112 | None |
| A0A6T6H7N9 | 10-129 | None |
| I4YCA1 | 5-120 | None |
| A0A7S0TI78 | 49-185 | None |
| A0A2K6KI05 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.