DPCstruct | MC58863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 134 ± 28 aa |
| Standard deviation of domain lengths | 27.53 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 72.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.79 |
| Pfam Score | 95.92 |
| Assigned Pfam label(s) | CL0662- PF10419 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9NC55 | 1-124 | MSPESRRPDENAEEDEYEEEVSYVTLDFGSNPLSIDQIKEYQLIGLDSKTPVIRLGQNIYRGTWNELLGTEIILEKAGDTSRVVGLS… |
| A0A0M3JRC6 | 1-85 | MDVAYTQSAIGTHDCSVRRANTGAPLVQISNALYTAQWEFANGSDMILRCDCSDSGLVSAQQQQLVPIGASDVRLVAEKALVTPK |
| A0A067K5F2 | 85-213 | None |
| A0A6A4VXR2 | 232-347 | None |
| R1EEQ2 | 62-197 | None |
| A0A7R9AY99 | 4-129 | None |
| A0A2K1II47 | 56-216 | None |
| A0A284RDI0 | 30-137 | None |
| A0A284R405 | 14-146 | None |
| A0A1J9RXU8 | 54-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.