DPCstruct | MC5886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 133 ± 11 aa |
| Standard deviation of domain lengths | 11.41 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19848 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3QY98 | 11-143 | QNKSIIVAKNELLKINDESSAYGLILTPQDVEEIIKSRGYSLKNYGRIDLNMDVTKKLINKIYTSQYTDKDDYVEIINDLQDIFYYL… |
| A0A2V2FDU7 | 19-144 | VEEVTALNTLTAAQGLTLTEAQAAELVAARREALVQTGRVEFGSGVTEKLIRAFYTLPYLTKETYAETLQALTELFYQLKNETDDRV… |
| A0A2N0KEW3 | 8-144 | None |
| A0A6N8ID03 | 17-150 | None |
| R6E389 | 4-119 | None |
| A0A1C6G379 | 9-129 | None |
| A0A2N3FFY0 | 10-148 | None |
| A0A1V4ISU7 | 12-148 | None |
| A0A3B9T3V8 | 16-173 | None |
| R5AEZ8 | 6-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.