DPCstruct | MC58858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 336 |
|---|---|
| Mean domain length (aa) | 340 ± 77 aa |
| Standard deviation of domain lengths | 76.59 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.43 |
| Pfam Score | 68.43 |
| Assigned Pfam label(s) | CL0023- PF03311- PF08353- PF02990- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534HU28 | 12-227 | IEARCRELRAPLTVVGRDVYAQRGAHDLQGQEVRVRGPFGEIDVRTPLLGSFQVENAAVAVAALAELRSAGFAIPDRAIREGVEAVR… |
| A0A7W2A0B6 | 24-362 | VAGDNTGPVSAQLVLKDPSVQVAVLETARGGIIRSGLGYDHCDVAVVTNIAADHLGLKDINTLEDLARVKAVVPRSVSRKGFAVLNA… |
| A0A2U2BQH3 | 625-1021 | None |
| A0A199VI59 | 376-786 | None |
| A0A1V5FPT7 | 280-655 | None |
| A0A2H0BFP3 | 72-444 | None |
| A0A1V5UV84 | 67-410 | None |
| A0A348XL57 | 63-444 | None |
| K1V166 | 8-183 | None |
| A0A2M8Q114 | 58-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.