DPCstruct | MC58857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 164 ± 29 aa |
| Standard deviation of domain lengths | 28.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1ZXU4 | 28-178 | PALVLIILLFIFARKDFISRIPLKTLTLLHVIRIPVEIVLLWLFQNGQVPQLMTFEGRNFDILSGLTAPIIAWLAFRNGKTNRPLLI… |
| A0A7C3PT19 | 61-222 | PPRAVLMPLPALLLIVILFLTRKGRSFIDRLDPRMLTWLHIVRVPVEICLLFLFIRGHIPQLMTFEGRNFDIIAGITAPLIAYFGFS… |
| A0A6J4I5X8 | 87-234 | None |
| A0A2V6PXC2 | 22-191 | None |
| A0A0B1XW31 | 2-158 | None |
| C6W314 | 44-232 | None |
| A0A539CPQ1 | 1-138 | None |
| A0A1Z9BUD6 | 121-291 | None |
| A0A7Y5V5Y0 | 7-184 | None |
| A0A259U1P8 | 52-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.