DPCstruct | MC58855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 77 ± 12 aa |
| Standard deviation of domain lengths | 12.20 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 93.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1W7F6 | 24-100 | FFTRRGKSLAITNRGEDYKPGDVVAWDLDGKGLTHIGLVSNIYNETTKRYLIIHNIGGGTQAEDKVFDWKIIGHYRY |
| A0A4Z0I5U0 | 122-204 | VPNLETWFTRHDKTRPTSKNAGDYQAGDIVSWRLDNGLAHIGVVSDGFARDGTPLVIHNIGAGAQEEDVLFSWRMVGHYRYFV |
| A0A3A4XN72 | 37-105 | None |
| X0RFE5 | 7-75 | None |
| A0A7X9D764 | 313-391 | None |
| A0A7V2T0F6 | 344-415 | None |
| A0A7V9DDJ9 | 17-87 | None |
| A0A7C8D8C5 | 103-183 | None |
| A0A2N2C313 | 227-319 | None |
| W4P6G7 | 89-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.