DPCstruct | MC58853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 198 ± 31 aa |
| Standard deviation of domain lengths | 31.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14921 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1W4Y0 | 278-446 | LPVTNEQLSGTWKSAAAENIGSGIFRTRKFTFTKERWLIEVVIYGDKEMTEALFSFVGEGPYKLGEVSTIAPGATNAVFRFDKKSLT… |
| A0A382P775 | 7-156 | TVSGTYAYACSRLISGGPSDATHVGWILVITGSSSFTEESNYYTDSACTSLSYGRYDNFDNVTVGEASGSDYKVTYTQTNYTLFANT… |
| A0A673H0G0 | 50-238 | None |
| B7PBL6 | 40-231 | None |
| B7PBL4 | 2-142 | None |
| A0A1I8FA81 | 183-343 | None |
| A0A1Y6CSR1 | 40-215 | None |
| A0A7M5X9I6 | 267-433 | None |
| A0A7R9P0A6 | 448-704 | None |
| T1EU38 | 20-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.