DPCstruct | MC5885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 399 ± 39 aa |
| Standard deviation of domain lengths | 39.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8ET58 | 6-433 | RVIVFTLLVFVAFICIQIKVEAEVSVNDEVEVDHLKSKIQSLESNVEDTAKELKRKDEVIAGKEDMIKEKSETIASLLAQIDSLQKK… |
| A0A7J0DX48 | 1-386 | MAMRPLLVLSIFLALILATKVSADASTAVNEHQHEEQAEEVVRSDGFDSSLKIELDQLKSHVLALESHVDEKTRELKNKDDILANKE… |
| A0A1D6ESJ0 | 6-434 | None |
| A0A453RL23 | 5-427 | None |
| A0A833RSD6 | 4-329 | None |
| A0A2P5WRL1 | 5-451 | None |
| A0A6P5GMT1 | 74-507 | None |
| A0A5N5MGS1 | 1-440 | None |
| A0A4D9B871 | 799-1166 | None |
| A0A0K9Q139 | 1-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.