DPCstruct | MC58848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 369 ± 92 aa |
| Standard deviation of domain lengths | 92.18 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 67.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.82 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0023- PF09746 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3F372 | 5-353 | RLGENIGALGTPRDRLFQALYYRAAYIYHITVAVSVRRFIEFIVLLMAILLFGLVTYVHIVFTRQQPSCLESVRHLWPRNGILNVHI… |
| F0YGC8 | 4-435 | ERVLYRVHASTLASLERNRERLHVRPLNACWIVTELTFVVAVSLLLLSTALHASLERGNCLAPQLAEALRVQAPPGSNASDGGWRLP… |
| A0A6A4KKU4 | 152-500 | None |
| A0A7G2E382 | 5-462 | None |
| A0A2A6CW06 | 241-698 | None |
| A0A1D6GL30 | 19-420 | None |
| A0A2A4K215 | 9-425 | None |
| A0A6V7XNI0 | 31-346 | None |
| A0A024U7J8 | 2-208 | None |
| W2Z221 | 10-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.