DPCstruct | MC58847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 116 ± 6 aa |
| Standard deviation of domain lengths | 5.74 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 42.40 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF08337- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182T7G4 | 1-114 | MDSCSTSDHRLGKDSPSSKLLYAKDIPSYREWVERYYNDIRDMPAISDQDMNAMLAEESRLHTTEFNTNCALHELYQYAVKYNEQLT… |
| A0A671SH40 | 80-193 | MDSCSTSEHRLGKDSPSNKLLYAKDIPNYKNWVERYYADISRLPAISDQDMNAYLAEQARLHSNEFNMLSALNEIYSYISKYSEEIT… |
| A0A1B0DHC7 | 117-243 | None |
| A0A6A4SBK2 | 36-154 | None |
| A0A077Z670 | 1797-1903 | None |
| A0A0K0E5W4 | 32-146 | None |
| A0A3B3QIQ7 | 279-391 | None |
| D4AA77 | 1595-1716 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.