DPCstruct | MC58844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 494 |
|---|---|
| Mean domain length (aa) | 654 ± 151 aa |
| Standard deviation of domain lengths | 151.23 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 65.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.17 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 15.23 |
| Pfam Score | 3.18 |
| Assigned Pfam label(s) | CL0679- PF09738- PF13868- PF04849- PF15743 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3EUA0 | 46-682 | KSVDDESSNWIASRMGIDAKSRTMAAWPVLSSSGSPPCSTDSGDEASAFAGVEYDVHSCVNFLISEVCSRVEPTTMTKEDDYCSDPL… |
| A0A7E6DGL4 | 1-572 | MKDRSSTPPLHVHVDENTPVHVHIKKLPKPSAASSQKSHKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTE… |
| A0A2H3C2H6 | 228-1005 | None |
| A0A2G2XDU9 | 2-432 | None |
| H9GL85 | 252-1139 | None |
| A0A1V9Z2X2 | 83-701 | None |
| A0A1V9YZ75 | 13-775 | None |
| A0A0S7DYI3 | 1-724 | None |
| A0A4W2G7E5 | 43-826 | None |
| A0A3Q0F9G1 | 100-645 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.