DPCstruct | MC58840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 96 ± 4 aa |
| Standard deviation of domain lengths | 4.02 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3EPW5 | 1-92 | MLQVFDIDVKSKVKSCQFSEEVVFWRWLDVNNIALVSPTSVYHWTMESESVPVKMFDRMQSLNDRRIINYKTDSKYMWLLLMGIVSL… |
| A0A6P9DK83 | 42-138 | MNPASKVIALKDAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWISVNTVALVTETAVYHWSMEGDSLPQKMFDRHASLAGCQIINYRT… |
| A0A4X3P543 | 69-163 | None |
| A0A6P6XMK6 | 253-355 | None |
| A0A438E3R9 | 37-126 | None |
| A0A1C1CBU5 | 76-170 | None |
| A0A7R9QRW2 | 149-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.