DPCstruct | MC5884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 55.94 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF05678- PF14778 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S6RC12 | 1-100 | MVKTVVGEEAQLKALEETLSASASPAQVGLVVGKLSASSDRALAYSLIPTPPTDSGAPACSLLRAAPNPKAAKAASSDASSSLDFDV… |
| A0A7J0DWF7 | 1-98 | MVKAVVGEEWRLKPAEDGLDQSSIRSQVGLVIGKLSPSSDRGLVFDLVPTPPNDAGEPACSIVDSGRDEKKMVSKGKSQADSSSLFI… |
| A0A287X0F5 | 1-120 | None |
| A0A0L9UGH4 | 1-102 | None |
| A0A165X9Z2 | 1-100 | None |
| A0A7J7LXL5 | 33-140 | None |
| A0A2P2JSM7 | 1-103 | None |
| A0A4D6NVZ6 | 1-119 | None |
| A0A7J7HSS0 | 55-167 | None |
| A0A1S3X2T6 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.