DPCstruct | MC58837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 155 ± 44 aa |
| Standard deviation of domain lengths | 43.71 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 86.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.72 |
| Pfam Score | 91.30 |
| Assigned Pfam label(s) | PF12896- CL0063- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3EJY6 | 14-161 | LCKVKQNKQDRQFCFTCGHFVLPEERSEHVQHKLKFNITNRLLNRPCMWLTASKSEKKEAQYWFSDSCAKFLAKLPLELSFDHVLCI… |
| A0A6J0BRS6 | 94-240 | LNEILAINPIRRIYCHDCGRLSFVSEKHKHRGHDIIENLTDHQLRHPTEFLRPLENPKKEAQYLFSDQSVSDIIFMLLNLGAKHILC… |
| A0A2H2IHS7 | 154-265 | None |
| A0A183H7J4 | 116-231 | None |
| A0A368FQA4 | 4-144 | None |
| A0A7R9PPZ8 | 129-249 | None |
| A0A0N4WKQ0 | 61-156 | None |
| A0A834PBK7 | 79-273 | None |
| A0A5A9PYS4 | 18-145 | None |
| A0A4Z2BM65 | 7-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.